Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0,00 €
Suncatchers
Bee sunctcher
Bee sunctcher
9,95 €
Butterfly Suncatcher
Butterfly Suncatcher
9,95 €
Dragonfly Suncatcher
Dragonfly Suncatcher
9,95 €
Elephant suncatcher
Elephant suncatcher
9,95 €
Flamingo Suncatcher
Flamingo Suncatcher
9,95 €
Humming Bird Suncatcher
Humming Bird Suncatcher
9,95 €
Humming Bird Swirley Suncatcher
Humming Bird Swirley Suncatcher
9,95 €
Owl suncatcher
Owl suncatcher
9,95 €
Tree of life suncatcher
Tree of life suncatcher
9,95 €
Unicorn Suncatcher
Unicorn Suncatcher
9,95 €
Welsh Dragon Suncatcher
Welsh Dragon Suncatcher
9,95 €
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i